Iright
BRAND / VENDOR: Proteintech

Proteintech, 60178-1-Ig, BCL2 Monoclonal antibody

CATALOG NUMBER: 60178-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The BCL2 (60178-1-Ig) by Proteintech is a Monoclonal antibody targeting BCL2 in IHC, IF/ICC, IF-P, IP, ELISA applications with reactivity to human, pig samples 60178-1-Ig targets BCL2 in IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive IP detected in: U-937 cells Positive IHC detected in: human appendicitis tissue, human lymphoma tissue, human tonsillitis tissue, Jurkat cellsNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human appendicitis tissue, human tonsillitis tissue Positive IF/ICC detected in: MCF-7 cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:6400-1:25600 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information 1) What is Bcl-2?Bcl-2 (B-cell lymphoma 2) is an outer mitochondrial membrane protein that via heterodimerization with BAX proteins controls apoptosis. Abnormalities of Bcl-2 activity can lead to cancer, autoimmune diseases, and schizophrenia.2) FAQs for Bcl-2A) How to measure Bcl-2 and Bax apoptotic markers by western blottingGenerally, Bcl-2 protein is considered to have anti-apoptotic activity, while Bax has apoptotic activity. Comparing the ratio between Bcl-2 and Bax protein levels in different samples or cells subjected to treatments can reflect the apoptotic state of the cells. Expression of Bax can vary between cell lines and it is important to compare it to Bcl-2 levels.B) What band size should I expect in western blotting for Bcl-2?The molecular weight of Bcl-2 is 26 kDa. Specification Tested Reactivity: human, pig Cited Reactivity: human, pig, rabbit, monkey, bovine, hamster Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag3508 Product name: Recombinant human BCL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-239 aa of BC027258 Sequence: MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK Predict reactive species Full Name: B-cell CLL/lymphoma 2 Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC027258 Gene Symbol: BCL2 Gene ID (NCBI): 596 RRID: AB_10734459 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P10415 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA. FAQ A) How to measure Bcl-2 and Bax apoptotic markers by western blottingGenerally, Bcl-2 protein is considered to have anti-apoptotic activity, while Bax has apoptotic activity. Comparing the ratio between Bcl-2 and Bax protein levels in different samples or cells subjected to treatments can reflect the apoptotic state of the cells. Expression of Bax can vary between cell lines and it is important to compare it to Bcl-2 levels.B) What band size should I expect in western blotting for Bcl-2?The molecular weight of Bcl-2 is 26 kDa. ProtocolsProduct Specific ProtocolsIF protocol for BCL2 antibody 60178-1-IgDownload protocolIHC protocol for BCL2 antibody 60178-1-IgDownload protocolIP protocol for BCL2 antibody 60178-1-IgDownload protocolStandard ProtocolsClick here to view our Standard Protocols ProtocolsProduct Specific ProtocolsIF protocol for BCL2 antibody 60178-1-IgDownload protocolIHC protocol for BCL2 antibody 60178-1-IgDownload protocolIP protocol for BCL2 antibody 60178-1-IgDownload protocolStandard ProtocolsClick here to view our Standard Protocols

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924