Iright
BRAND / VENDOR: Proteintech

Proteintech, 60197-1-Ig, ESR2 Monoclonal antibody

CATALOG NUMBER: 60197-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ESR2 (60197-1-Ig) by Proteintech is a Monoclonal antibody targeting ESR2 in WB, ELISA applications with reactivity to human samples 60197-1-Ig targets ESR2 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, human brain tissue, SW 1990 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Estrogen receptor-beta (ESR2) is a member of the superfamily of nuclear receptors, which can transduce extracellular signals into transcriptional responses. It binds estrogens with an affinity similar to that of ESR1, and activates expression of reporter genes containing estrogen response elements (ERE) in an estrogen-dependent manner. DNA-binding by ESR1 and ESR2 is rapidly lost at 37 degrees Celsius in the absence of ligand while in the presence of 17 beta-estradiol and 4-hydroxy-tamoxifen loss in DNA-binding at elevated temperature is more gradual. ESR2 exists various isoform and range of calculated molecular weight of isoforms is 50-60 kDa. The experiment detected two bands for ESR2 in isolated human germ cells, one at 60 kDa and a weaker one at 50 kDa (PMID: 14766008). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5103 Product name: Recombinant human ESR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-323 aa of BC024181 Sequence: MDIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGMRGNA Predict reactive species Full Name: estrogen receptor 2 (ER beta) Calculated Molecular Weight: 59 kDa Observed Molecular Weight: 50-60 kDa GenBank Accession Number: BC024181 Gene Symbol: ESR2 Gene ID (NCBI): 2100 RRID: AB_10897162 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q92731 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924