Proteintech, 60216-1-Ig, CXCR7 Monoclonal antibody

Size: 20ul / 150ul The CXCR7 (60216-1-Ig) by Proteintech is a Monoclonal antibody targeting CXCR7 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples 60216-1-Ig targets CXCR7 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: PC-3 cells, U-87 MG cells, Jurkat cells, Raji cells, K-562 cells, THP-1 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human breast cancer tissue, human prostate cancer tissue, mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information CXCR7 (C-X-C chemokine receptor type 7), also known as RDC1, is a member of the G-protein coupled receptor family. CXCR7 can bind the chemokines CXCL11 and CXCL12 with high affinity, and it also acts as a coreceptor with CXCR4 for a restricted number of HIV isolates. Expression of CXCR7 has been associated with cardiac development as well as with tumor growth and progression. This antibody recognizes endogenous CXCR7, which has an experimentally determined molecular weight of 50 kDa (PMID: 20197403; 20388803). Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag14247 Product name: Recombinant human CXCR7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 273-362 aa of BC036661 Sequence: LLDIFSILHYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK Predict reactive species Full Name: chemokine (C-X-C motif) receptor 7 Calculated Molecular Weight: 362 aa, 41 kDa Observed Molecular Weight: 50-60 kDa GenBank Accession Number: BC036661 Gene Symbol: CXCR7 Gene ID (NCBI): 57007 RRID: AB_11182925 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P25106 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.