Iright
BRAND / VENDOR: Proteintech

Proteintech, 60270-1-Ig, IL-28A Monoclonal antibody

CATALOG NUMBER: 60270-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IL-28A (60270-1-Ig) by Proteintech is a Monoclonal antibody targeting IL-28A in IHC, IF-P, ELISA applications with reactivity to human samples 60270-1-Ig targets IL-28A in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human tonsillitis tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Recommended dilution Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information IL28A, also named as IFNL2 and ZCYT020, is a cytokine with immunomodulatory activity. It up-regulates MHC class I antigen expression. IL28A is a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IFNLR1. The ligand/receptor complex seems to signal through the Jak-STAT pathway. It plays a significant role in the antiviral immune defense in the intestinal epithelium. Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Affinity: K D =1.77 x 10 9 M K Off =4.10 x 10 -5 M K On =2.31 x 10 4 M Immunogen: CatNo: Ag18525 Product name: Recombinant human IL-28A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-91 aa of BC113583 Sequence: TVTGAVPVARLHGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCRCHSRLFPRTWDLRQLQV Predict reactive species Full Name: interleukin 28A (interferon, lambda 2) Calculated Molecular Weight: 200 aa, 22 kDa GenBank Accession Number: BC113583 Gene Symbol: IL-28A Gene ID (NCBI): 282616 RRID: AB_2881390 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q8IZJ0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924