Iright
BRAND / VENDOR: Proteintech

Proteintech, 60273-1-Ig, CRYBB1 Monoclonal antibody

CATALOG NUMBER: 60273-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CRYBB1 (60273-1-Ig) by Proteintech is a Monoclonal antibody targeting CRYBB1 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat, rabbit samples 60273-1-Ig targets CRYBB1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, rabbit samples. Tested Applications Positive WB detected in: rat eye tissue, C6 cells, mouse eye tissue, rabbit eye tissue Positive IF/ICC detected in: hTERT-RPE1 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200 Background Information Mutation in CRYBB1 is associated with congenital Cataract-Microcornea Syndrome. Specification Tested Reactivity: human, mouse, rat, rabbit Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag4722 Product name: Recombinant human CRYBB1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-252 aa of BC036790 Sequence: MSQAAKASASATVAVNPGPDTKGKGAPPAGTSPSPGTTLAPTTVPITSAKAAELPPGNYRLVVFELENFQGRRAEFSGECSNLADRGFDRVRSIIVSAGPWVAFEQSNFRGEMFILEKGEYPRWNTWSSSYRSDRLMSFRPIKMDAQEHKISLFEGANFKGNTIEIQGDDAPSLWVYGFSDRVGSVKVSSGTWVGYQYPGYRGYQYLLEPGDFRHWNEWGAFQPQMQSLRRLRDKQWHLEGSFPVLATEPPK Predict reactive species Full Name: crystallin, beta B1 Calculated Molecular Weight: 252 aa, 28 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC036790 Gene Symbol: CRYBB1 Gene ID (NCBI): 1414 RRID: AB_2881393 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P53674 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924