Iright
BRAND / VENDOR: Proteintech

Proteintech, 60282-1-Ig, FAM3C Monoclonal antibody

CATALOG NUMBER: 60282-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FAM3C (60282-1-Ig) by Proteintech is a Monoclonal antibody targeting FAM3C in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 60282-1-Ig targets FAM3C in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: fetal human brain tissue Positive IHC detected in: human oesophagus cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information FAM3C, also known as ILEI, is a secreted protein belonging to the cytokine-like protein family. FAM3C is a signaling cytokine with a GG domain, hydrophobic leader sequence and an N-terminal signal peptide. A change in expression of this protein has been noted in pancreatic cancer-derived cells. FAM3C has been involved in the epithelial to mesenchymal transition, and retinal laminar formation processes in vertebrates. Also, FAM3C may play an important role in inner ear development and thus be involved in cell differentiation and proliferation during inner ear embryogenesis. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag5516 Product name: Recombinant human FAM3C protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 30-227 aa of BC046932 Sequence: KMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD Predict reactive species Full Name: family with sequence similarity 3, member C Calculated Molecular Weight: 25 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC046932 Gene Symbol: FAM3C Gene ID (NCBI): 10447 RRID: AB_2881400 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q92520 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924