Proteintech, 60286-1-Ig, PRDX4 Monoclonal antibody

Size: 20ul / 150ul The PRDX4 (60286-1-Ig) by Proteintech is a Monoclonal antibody targeting PRDX4 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 60286-1-Ig targets PRDX4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: LNCaP cells, NIH/3T3 cells, HeLa cells, HepG2 cells, K-562 cells, PC-12 cells, HEK-293 cells, Jurkat cells, HSC-T6 cells Positive IHC detected in: human colon tissue, human pancreas cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information PRDX4(Peroxiredoxin-4) is also named as AOE37-2, Prx-IV and belongs to the AhpC/TSA family. PRDX4 is associated with acrosome formation during rat spermatogenesis and has a protective role in the male reproductive tract, because the phenotype of mice lacking this isoform includes testicular atrophy and increased sperm DNA damage(PMID:20864641). It is initially synthesized as a membrane-binding 31-kDa protein and processed into a 27-kDa secretory form and is discarded with the residual bodies(PMID:19208552). PRDX4 is a pentamer of dimers(PMID:23025503). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag13401 Product name: Recombinant human PRDX4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-271 aa of BC007107 Sequence: MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN Predict reactive species Full Name: peroxiredoxin 4 Calculated Molecular Weight: 31 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC007107 Gene Symbol: PRDX4 Gene ID (NCBI): 10549 RRID: AB_2881403 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13162 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.