Iright
BRAND / VENDOR: Proteintech

Proteintech, 60413-1-Ig, EVI1 Monoclonal antibody

CATALOG NUMBER: 60413-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EVI1 (60413-1-Ig) by Proteintech is a Monoclonal antibody targeting EVI1 in WB, ELISA applications with reactivity to human, mouse, rat samples 60413-1-Ig targets EVI1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MKN-45 cells, Calu-3 cells, MDA-MB-231 cells, HeLa cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag34143 Product name: Recombinant human EVI1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1032-1230 aa of NM_001105077 Sequence: NSNHGSQSPRNVEERMNGSHFKDEKALVTSQNSDLLDDEEVEDEVLLDEEDEDNDITGKTGKEPVTSNLHEGNPEDDYEETSALEMSCKTSPVRYKEEEYKSGLSALDHIRHFTDSLKMRKMEDNQYSEAELSSFSTSHVPEELKQPLHRKSKSQAYAMMLSLSDKESLHSTSHSSSNVWHSMARAAAESSAIQSISHV Predict reactive species Full Name: ecotropic viral integration site 1 Calculated Molecular Weight: 138 kDa Observed Molecular Weight: 140-150 kDa GenBank Accession Number: NM_001105077 Gene Symbol: EVI1 Gene ID (NCBI): 2122 RRID: AB_3670256 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q03112 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924