Proteintech, 60434-1-Ig, ATP5L Monoclonal antibody

Size: 20ul / 150ul The ATP5L (60434-1-Ig) by Proteintech is a Monoclonal antibody targeting ATP5L in IF/ICC, ELISA applications with reactivity to human samples 60434-1-Ig targets ATP5L in IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IF/ICC detected in: HepG2 cells Recommended dilution Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information Mitochondrial membrane ATP synthase (F1-Fo ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. It is composed of the soluble catalytic core, F1, and the membrane-spanning component and Fo, which comprises the proton channel. The Fo seems to have nine subunits (a, b, c, d, e, f, g, F6 and 8). ATP5L gene encodes ATP synthase subunit g of the Fo complex. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9287 Product name: Recombinant human ATP5L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC015128 Sequence: MAQFVRNLVEKTPALVNAAVTYSKPRLATFWYYAKVELVPPTPAEIPRAIQSLKKIANSAQTGSFKQLTVKEAVLNGLVATEVLMWFYVGEIIGKRGIIGYDV Predict reactive species Full Name: ATP synthase, H+ transporting, mitochondrial F0 complex, subunit G Calculated Molecular Weight: 11 kDa GenBank Accession Number: BC015128 Gene Symbol: ATP5L Gene ID (NCBI): 10632 RRID: AB_3670259 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O75964 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.