Iright
BRAND / VENDOR: Proteintech

Proteintech, 60494-1-Ig, DCP1A Monoclonal antibody

CATALOG NUMBER: 60494-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DCP1A (60494-1-Ig) by Proteintech is a Monoclonal antibody targeting DCP1A in WB, ELISA applications with reactivity to human, mouse, rat, pig samples 60494-1-Ig targets DCP1A in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: LoVo cells, HEK-293 cells, rat brain tissue, HCT 116 cells, Jurkat cells, MOLT-4 cells, Raji cells, mouse brain tissue, pig brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information DCP1 decapping enzyme homolog A (S. cerevisiae), known as mRNA-decapping enzyme 1A (DCP1A),is necessary for the degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Removes the 7-methyl guanine cap structure from mRNA molecules, yielding a 5'-phosphorylated mRNA fragment and 7m-GDP. Contributes to the transactivation of target genes after stimulation by TGFB1. This antibody specifically react with the 70kd DCP1A protein. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18706 Product name: Recombinant human DCP1A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-350 aa of BC007439 Sequence: MEALSRAGQEMSLAALKQHDPYITSIADLTGQVALYTFCPKANQWEKTDIEGTLFVYRRSASPYHGFTIVNRLNMHNLVEPVNKDLEFQLHEPFLLYRNASLSIYSIWFYDKNDCHRIAKLMADVVEEETRRSQQAARDKQSPSQANGCSDHRPIDILEMLSRAKDEYERNQMGDSNISSPGLQPSTQLSNLGSTETLEEMPSGSQDKSAPSGHKHLTVEELFGTSLPKEQPAVVGLDSEEMERLPGDASQKEPNSFLPFPFEQLGGAPQSETLGVPSAAHHSVQPEITTPVLITPASITQSNEKHAPTYTIPLSPVLSPTLPAEAPTAQVPPSLPRNSTMMQAVKTTPR Predict reactive species Full Name: DCP1 decapping enzyme homolog A (S. cerevisiae) Calculated Molecular Weight: 582 aa, 63 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC007439 Gene Symbol: DCP1A Gene ID (NCBI): 55802 RRID: AB_3670263 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NPI6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924