Iright
BRAND / VENDOR: Proteintech

Proteintech, 60498-1-Ig, PIAS1 Monoclonal antibody

CATALOG NUMBER: 60498-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PIAS1 (60498-1-Ig) by Proteintech is a Monoclonal antibody targeting PIAS1 in WB, ELISA applications with reactivity to human samples 60498-1-Ig targets PIAS1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MOLT-4 cells, THP-1 cells, Jurkat cells, IMR-32 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18132 Product name: Recombinant human PIAS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 475-651 aa of BC121797 Sequence: PSAKRTCPSLSPTSPLNNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDLQGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTSLPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISLD Predict reactive species Full Name: protein inhibitor of activated STAT, 1 Calculated Molecular Weight: 651 aa, 72 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC121797 Gene Symbol: PIAS1 Gene ID (NCBI): 8554 RRID: AB_3670265 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O75925 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924