Iright
BRAND / VENDOR: Proteintech

Proteintech, 60749-1-Ig, MUC1/CA15-3 Monoclonal antibody

CATALOG NUMBER: 60749-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MUC1/CA15-3 (60749-1-Ig) by Proteintech is a Monoclonal antibody targeting MUC1/CA15-3 in IHC, IF/ICC, ELISA applications with reactivity to human samples 60749-1-Ig targets MUC1/CA15-3 in IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human rectal cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:1600-1:6400 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information MUC1 is a type I transmembrane glycoprotein expressed by various epithelial cells of the female reproductive tract, lung, breast, kidney, stomach, and pancreas.. Among the known mucins, MUC1 is best studied and plays crucial roles in regulating many cellular properties, including cell proliferation, apoptosis, adhesion, and invasion. MUC1 is overexpressed in a wide range of human epithelial malignancies. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17660 Product name: Recombinant human CA15-3,MUC1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1055-1255 aa of BC120975 Sequence: NSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL Predict reactive species Full Name: mucin 1, cell surface associated Calculated Molecular Weight: 1264 aa, 123 kDa GenBank Accession Number: BC120975 Gene Symbol: MUC1/CA15-3 Gene ID (NCBI): 4582 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P15941 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924