Proteintech, 60912-3-Ig, PRSS8 Monoclonal antibody

Size: 20ul / 150ul The PRSS8 (60912-3-Ig) by Proteintech is a Monoclonal antibody targeting PRSS8 in WB, ELISA applications with reactivity to human samples 60912-3-Ig targets PRSS8 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SK-BR-3 cells, Calu-3 cells, LNCaP cells, BT-474 cells, HT-1376 cells, Caco-2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Protease serine S1 family member 8 (PRSS8), a membrane-anchored serine protease, has been reported to be involved in the development of several human cancers. PRSS8 protein level was highly expressed in well differentiated cancer cell and was lower or absent in poorly differentiated cancer cell. Significantly higher levels of prostasin were found in early stage OVC serum samples compared to benign ovarian and normal donor samples. Overexpression of PRSS8 mRNA and high levels of prostasin in multiple subtypes of early stage ovarian tumors may provide clinical biomarkers for early detection of OVC. (PMID: 27036110, PMID: 27050145) Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7234 Product name: Recombinant human PRSS8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 26-325 aa of BC001462 Sequence: SGTGAEGAEAPCGVAPQARITGGSSAVAGQWPWQVSITYEGVHVCGGSLVSEQWVLSAAHCFPSEHHKEAYEVKLGAHQLDSYSEDAKVSTLKDIIPHPSYLQEGSQGDIALLQLSRPITFSRYIRPICLPAANASFPNGLHCTVTGWGHVAPSVSLLTPKPLQQLEVPLISRETCNCLYNIDAKPEEPHFVQEDMVCAGYVEGGKDACQGDSGGPLSCPVEGLWYLTGIVSWGDACGARNRPGVYTLASSYASWIQSKVTELQPRVVPQTQESQPDSNLCGSHLAFSSAPAQGLLRPIL Predict reactive species Full Name: protease, serine, 8 Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 39 kDa GenBank Accession Number: BC001462 Gene Symbol: PRSS8 Gene ID (NCBI): 5652 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q16651 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.