Iright
BRAND / VENDOR: Proteintech

Proteintech, 60932-3-Ig, S100A7/Psoriasin Monoclonal antibody

CATALOG NUMBER: 60932-3-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The S100A7/Psoriasin (60932-3-Ig) by Proteintech is a Monoclonal antibody targeting S100A7/Psoriasin in WB, ELISA applications with reactivity to human samples 60932-3-Ig targets S100A7/Psoriasin in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HT-1376 cells, MDA-MB-468 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information S100A7 (psoriasin), a member of the S100 protein family, is a well-known antimicrobial peptide and a signaling molecule which regulates cellular function and is expressed in many squamous cell carcinomas (SCCs), such as SCC of the skin. It is an EF-hand type calcium binding protein localized in epithelial cells, regulates cell proliferation and differentiation. The protein is overexpressed in hyperproliferative skin diseases, exhibits antimicrobial activities against bacteria and induces immunomodulatory activities. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag23611 Product name: Recombinant human S100A7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-101 aa of BC034687 Sequence: MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ Predict reactive species Full Name: S100 calcium binding protein A7 Calculated Molecular Weight: 101 aa, 11 kDa Observed Molecular Weight: 11 kDa GenBank Accession Number: BC034687 Gene Symbol: S100A7/Psoriasin Gene ID (NCBI): 6278 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P31151 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924