Iright
BRAND / VENDOR: Proteintech

Proteintech, 66050-1-Ig, NDUFA4L2 Monoclonal antibody

CATALOG NUMBER: 66050-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NDUFA4L2 (66050-1-Ig) by Proteintech is a Monoclonal antibody targeting NDUFA4L2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 66050-1-Ig targets NDUFA4L2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Hela cells Positive IHC detected in: human breast cancer tissue, human renal cell carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HUVEC cells, OS-RC-2 cells, MCF-7 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information NDUFA4L2, also named as NUOMS, is a HIF-1α target gene that localizes to the mitochondria. It downregulates oxygen consumption and Complex I activity in hypoxia. NDUFA4L2 is involved in hypoxic adaptation by decreasing mitochondrial ROS production. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9233 Product name: Recombinant human NDUFA4L2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-87 aa of BC011910 Sequence: MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKFLAVSTDYKKLKKDRPDF Predict reactive species Full Name: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 4-like 2 Calculated Molecular Weight: 87 aa, 10 kDa Observed Molecular Weight: 10 kDa GenBank Accession Number: BC011910 Gene Symbol: NDUFA4L2 Gene ID (NCBI): 56901 RRID: AB_11045656 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NRX3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924