Product Description
Size: 20ul / 150ul
The SRP9 (66068-1-Ig) by Proteintech is a Monoclonal antibody targeting SRP9 in WB, ELISA applications with reactivity to human, rat, mouse samples
66068-1-Ig targets SRP9 in WB, ELISA applications and shows reactivity with human, rat, mouse samples.
Tested Applications
Positive WB detected in: HSC-T6 cells, HeLa cells, HEK-293 cells, ROS1728 cells, NIH/3T3 cells, 4T1 cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Background Information
Signal recognition particle 9(SRP9) is component of the signal recognition particle (SRP), which is a ribonucleoprotein complex that mediates the targeting of proteins to the rough endoplasmic reticulum (ER). SRP9 form a heterodimer with SRP14, which involves in arrest of the elongation of the nescent chains during targeting to ensure efficient translocation of the preprotein.
Specification
Tested Reactivity: human, rat, mouse
Cited Reactivity: human
Host / Isotype: Mouse / IgG2a
Class: Monoclonal
Type: Antibody
Immunogen: CatNo: Ag17153 Product name: Recombinant human SRP9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-86 aa of BC015094 Sequence: MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVKKIEKFHSQLMRLMVAKEARNVTMETE Predict reactive species
Full Name: signal recognition particle 9kDa
Calculated Molecular Weight: 10 kDa
Observed Molecular Weight: 10 kDa
GenBank Accession Number: BC015094
Gene Symbol: SRP9
Gene ID (NCBI): 6726
RRID: AB_11042618
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: P49458
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924