Proteintech, 66074-1-Ig, APOH Monoclonal antibody

Size: 20ul / 150ul The APOH (66074-1-Ig) by Proteintech is a Monoclonal antibody targeting APOH in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples 66074-1-Ig targets APOH in WB, IHC, IF/ICC, IF-P, Neutralization, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: human plasma, human testis tissue, pig plasma, human heart tissue, pig heart tissue, rabbit heart tissue, rat heart tissue, mouse heart tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue Positive IHC detected in: human liver cancer tissue, human colon cancer tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human liver cancer tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:100-1:800 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Apolipoprotein H (ApoH), also known as beta2-glycoprotein I (B2-GPI), is a plasma glycoprotein, primarily synthesized in the liver. It has an important function in blood coagulation and clearance of apoptotic bodies from the circulation. ApoH is also an important actor of host innate immune response through its capacity to bind with high affinity to a large panel of pathogens or their proteins. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17915 Product name: Recombinant human APOH protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 21-345 aa of BC026283 Sequence: RTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC Predict reactive species Full Name: apolipoprotein H (beta-2-glycoprotein I) Calculated Molecular Weight: 345 aa, 38 kDa Observed Molecular Weight: 50-53 kDa GenBank Accession Number: BC026283 Gene Symbol: APOH Gene ID (NCBI): 350 RRID: AB_11182392 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P02749 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.