Proteintech, 66094-1-Ig, Fetuin-A/AHSG Monoclonal antibody

Size: 20ul / 150ul The Fetuin-A/AHSG (66094-1-Ig) by Proteintech is a Monoclonal antibody targeting Fetuin-A/AHSG in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human samples 66094-1-Ig targets Fetuin-A/AHSG in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Hepg2 cells, human heart tissue, human plasma tissue Positive IP detected in: HepG2 cells Positive IHC detected in: human liver cancer tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Fetuin-A (alpha-2-HS-glycoprotein, AHSG), a liver borne plasma protein, contributes to the prevention of soft tissue calcification, modulates inflammation, reduces INS sensitivity and fosters weight gain following high fat diet or ageing. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, and it has therefore been postulated that it participates in the development of the tissues. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag10073 Product name: Recombinant human AHSG protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-367 aa of BC048198 Sequence: MKSLVLLLCLAQLWGCHSAPHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV Predict reactive species Full Name: alpha-2-HS-glycoprotein Calculated Molecular Weight: 367 aa, 39 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC048198 Gene Symbol: Fetuin-A Gene ID (NCBI): 197 RRID: AB_11232222 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P02765 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.