Proteintech, 66113-1-Ig, AFM Monoclonal antibody

Size: 20ul / 150ul The AFM (66113-1-Ig) by Proteintech is a Monoclonal antibody targeting AFM in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 66113-1-Ig targets AFM in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human plasma Positive IP detected in: human plasma tissue Positive IHC detected in: mouse brain tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information AFM (Afamin) is a member of the albumin superfamily, which comprises albumin, vitamin D-binding protein, a-fetoprotein, and afamin. AFM is present in the plasma/serum, cerebrospinal fluid, and follicular fluid, and functions as a vitamin E-binding protein. Alterations of expression level of AFM have been linked to variety of diseases like cancer. Specification Tested Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag16866 Product name: Recombinant human AFM protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 264-599 aa of BC109020 Sequence: SNYDGCCEGDVVQCIRDTSKVMNHICSKQDSISSKIKECCEKKIPERGQCIINSNKDDRPKDLSLREGKFTDSENVCQERDADPDTFFAKFTFEYSRRHPDLSIPELLRIVQIYKDLLRNCCNTENPPGCYRYAEDKFNETTEKSLKMVQQECKHFQNLGKDGLKYHYLIRLTKIAPQLSTEELVSLGEKMVTAFTTCCTLSEEFACVDNLADLVFGELCGVNENRTINPAVDHCCKTNFAFRRPCFESLKADKTYVPPPFSQDLFTFHADMCQSQNEELQRKTDRFLVNLVKLKHELTDEELQSLFTNFANVVDKCCKAESPEVCFNEESPKIGN Predict reactive species Full Name: afamin Calculated Molecular Weight: 599 aa, 69 kDa Observed Molecular Weight: 85 kDa GenBank Accession Number: BC109020 Gene Symbol: AFM Gene ID (NCBI): 173 RRID: AB_2881512 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P43652 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.