Iright
BRAND / VENDOR: Proteintech

Proteintech, 66127-1-Ig, AK2 Monoclonal antibody

CATALOG NUMBER: 66127-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The AK2 (66127-1-Ig) by Proteintech is a Monoclonal antibody targeting AK2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 66127-1-Ig targets AK2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, 4T1 cells Positive IHC detected in: human lung cancer tissue, human heart tissue, human kidney tissue, human liver tissue, human liver cancer tissue, mouse heart tissue, rat heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells, HeLa cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information AK2(Adenylate kinase 2, mitochondrial ) is also named as ADK2 and belongs to the adenylate kinase family. It plays a unique role in energy metabolism and energy transfer by regulating the ATP/ADP rate between the cytoplasma matrix and the mitochondria and it is increased expression during adipocyte and B cell differentiation(PMID:23020757). AK2 catalyzes the reversible transfer of a phosphoryl group from ATP to AMP(PMID:19043417). Defects in AK2 are the cause of reticular dysgenesis (RDYS)(PMID:19043416). It has 6 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17911 Product name: Recombinant human AK2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-202 aa of BC009405 Sequence: MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYR Predict reactive species Full Name: adenylate kinase 2 Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 29 kDa GenBank Accession Number: BC009405 Gene Symbol: AK2 Gene ID (NCBI): 204 RRID: AB_2881526 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P54819 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924