Proteintech, 66141-1-Ig, AEBP2 Monoclonal antibody

Size: 20ul / 150ul The AEBP2 (66141-1-Ig) by Proteintech is a Monoclonal antibody targeting AEBP2 in WB, ELISA applications with reactivity to human, pig samples 66141-1-Ig targets AEBP2 in WB, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information AEBP2 belongs to the AEBP2/jing C2H2-type zinc-finger family. It is a DNA-binding transcriptional repressor. AEBP2 is a zinc finger protein that has been shown to interact with the mammalian Polycomb Repression Complex 2 (PRC2). It may interact with and stimulate the activity of the PRC2 complex, which methylates 'Lys-9' and 'Lys-27' residues of histone H3. AEBP2 is an evolutionarily well-conserved gene that is found in the animals ranging from flying insects to mammals. (PMID:19293275) The antibody recognizes adult-specific larger form (52 kDa) and the embryo-specific smaller form (31 kDa). Specification Tested Reactivity: human, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17905 Product name: Recombinant human AEBP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-295 aa of BC015624 Sequence: MSSDGEPLSRMDSEDSISSTIMDVDSTISSGRSTPAMMNGQGSTTSSSKNIAYNCCWDQCQACFNSSPDLADHIRSIHVDGQRGGVFVCLWKGCKVYNTPSTSQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHVPTHFSQQNSSKVSSQPKAKEESPSKAGMNKRRKLKNKRRRSLPRPHDFFDAQTLDAIRHRAICFNLSAHIESLGKGHSVVFHSTVIAKRKEDSGKIKLLLHWMPEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQKRLKR Predict reactive species Full Name: AE binding protein 2 Calculated Molecular Weight: 33 kDa, 54 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC015624 Gene Symbol: AEBP2 Gene ID (NCBI): 121536 RRID: AB_2881538 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q6ZN18 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.