Proteintech, 66142-1-Ig, IL-4 Monoclonal antibody

Size: 20ul / 150ul The IL-4 (66142-1-Ig) by Proteintech is a Monoclonal antibody targeting IL-4 in WB, IHC, IF-P, FC (Intra), ELISA applications with reactivity to human, pig samples 66142-1-Ig targets IL-4 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: Jurkat cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human breast cancer tissue Positive FC (Intra) detected in: Ramos cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information IL4 is a cytokine produced by CD4+ T cells in response to helminthes and other extracellular parasites. It promotes the proliferation and differentiation of antigen presenting cells. IL4 also plays a pivotal role in antibody isotype switching and stimulates the production of IgE. This cytokine has been applied in the treatment of autoimmune disorder like multiple myeloma, cancer, psoriasis, and arthritis. IL4 has also been extensively applied to inhibit detrimental effect of Th1. It may promote the growth of epithelial tumors by mediating increased proliferation and survival. Specification Tested Reactivity: human, pig Cited Reactivity: human, mouse, rat, pig, bovine Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9940 Product name: Recombinant human IL-4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 24-153 aa of BC070123 Sequence: GHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS Predict reactive species Full Name: interleukin 4 Calculated Molecular Weight: 153 aa, 17 kDa Observed Molecular Weight: 18 kDa GenBank Accession Number: BC070123 Gene Symbol: IL-4 Gene ID (NCBI): 3565 RRID: AB_2881539 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P05112 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.