Proteintech, 66154-1-Ig, Complement factor B Monoclonal antibody

Size: 20ul / 150ul The Complement factor B (66154-1-Ig) by Proteintech is a Monoclonal antibody targeting Complement factor B in WB, IHC, IF-P, ELISA applications with reactivity to human samples 66154-1-Ig targets Complement factor B in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human blood tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human liver tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Complement factor B (CFB) is a component of the alternative pathway of complement activation. Complement factor B is cleaved into Ba and Bb by factor D in the presence of C3b. The active subunit Bb is a serine protease which associates with C3b to form the alternative pathway C3 convertase. Bb is involved in the proliferation of preactivated B lymphocytes, while Ba inhibits their proliferation. Specification Tested Reactivity: human Host / Isotype: Mouse / IgM Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag19107 Product name: Recombinant human CFB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 574-762 aa of BC007990 Sequence: DYDVALIKLKNKLKYGQTIRPICLPCTEGTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKNGDKKGSCERDAQYAPGYDKVKDISEVVTPRFLCTGGVSPYADPNTCRGDSGGPLIVHKRSRFIQVGVISWGVVDVCKNQKRQKQVPAHARDFHINLFQVLPWLKEKLQDEDLG Predict reactive species Full Name: complement factor B Calculated Molecular Weight: 86 kDa Observed Molecular Weight: 93 kDa GenBank Accession Number: BC007990 Gene Symbol: Complement factor B Gene ID (NCBI): 629 RRID: AB_2881550 Conjugate: Unconjugated Form: Liquid Purification Method: Caprylic acid/ammonium sulfate precipitation UNIPROT ID: P00751 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.