Iright
BRAND / VENDOR: Proteintech

Proteintech, 66156-1-Ig, Ceruloplasmin Monoclonal antibody

CATALOG NUMBER: 66156-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Ceruloplasmin (66156-1-Ig) by Proteintech is a Monoclonal antibody targeting Ceruloplasmin in WB, IHC, IF/ICC, ELISA applications with reactivity to human, rat samples 66156-1-Ig targets Ceruloplasmin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: human placenta tissue, rat liver tissue, HSC-T6 cells, human kidney tissue, human blood tissue Positive IHC detected in: human ovary tumor tissue, human placenta tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Ceruloplasmin (CP) is a serum glycoprotein synthesized by hepatocytes and functions as the major transport protein of copper in blood where it acts as ferrodoxidase and is required for iron transport of transferrin. The intact ceruloplasmin migrated around 130-140 kDa and some proteolytic cleaved fragments could also be observed. Specification Tested Reactivity: human, rat Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag15535 Product name: Recombinant human CP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 194-446 aa of BC146663 Sequence: IGPLIICKKDSLDKEKEKHIDREFVVMFSVVDENFSWYLEDNIKTYCSEPEKVDKDNEDFQESNRMYSVNGYTFGSLPGLSMCAEDRVKWYLFGMGNEVDVHAAFFHGQALTNKNYRIDTINLFPATLFDAYMVAQNPGEWMLSCQNLNHLKAGLQAFFQVQECNKSSSKDNIRGKHVRHYYIAAEEIIWNYAPSGIDIFTKENLTAPGSDSAVFFEQGTTRIGGSYKKLVYREYTDASFTNRKERGPEEEHL Predict reactive species Full Name: ceruloplasmin (ferroxidase) Calculated Molecular Weight: 1065 aa, 122 kDa Observed Molecular Weight: 140 kDa GenBank Accession Number: BC146663 Gene Symbol: Ceruloplasmin Gene ID (NCBI): 1356 RRID: AB_2881552 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P00450 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924