Iright
BRAND / VENDOR: Proteintech

Proteintech, 66175-1-Ig, Vitamin D binding protein Monoclonal antibody

CATALOG NUMBER: 66175-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Vitamin D binding protein (66175-1-Ig) by Proteintech is a Monoclonal antibody targeting Vitamin D binding protein in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human samples 66175-1-Ig targets Vitamin D binding protein in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human testis tissue Positive IHC detected in: human liver tissue, human colon cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: U-937 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Vitamin D binding protein is a sparsely glycosylated serum protein responsible for highly specific binding and tissue-specific delivery of vitamin D and its metabolites. In addition, it is also an actin scavenger, and is the precursor to the immunomodulatory protein, Gc-MAF. Vitamin D binding protein has been proposed to have significant roles in C5a chemotaxis, osteoclast development and possibly in macrophage activation/recruitment. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9803 Product name: Recombinant human VDBP,GC protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 120-474 aa of BC057228 Sequence: KLCMAALKHQPQEFPTYVEPTNDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLSLLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPEHTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFELSRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKKKLAERLKAKLPDATPTELAKLVNKRSDFASNCCSINSPPLYCDSEIDAELKNIL Predict reactive species Full Name: group-specific component (vitamin D binding protein) Calculated Molecular Weight: 474 aa, 53 kDa Observed Molecular Weight: 52-58 kDa GenBank Accession Number: BC057228 Gene Symbol: Vitamin D binding protein Gene ID (NCBI): 2638 RRID: AB_2881570 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P02774 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924