Proteintech, 66185-1-Ig, KLF15 Monoclonal antibody

Size: 20ul / 150ul The KLF15 (66185-1-Ig) by Proteintech is a Monoclonal antibody targeting KLF15 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 66185-1-Ig targets KLF15 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human skeletal muscle tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information KLF15, a kidney-enriched Krüppel-like zinc finger-containing transcription factors, is a transcriptional activator that binds the CLCNKA promoter. The nuclear protein KLF15, is expressed primarily in liver, heart, skeletal muscle and kidney tissues but is not detected in lymphoid tissues or bone marrow. It is an important regulator of GLUT4 in both adipose and muscle tissues.(PMID:10982849,PMID:16615998). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Mouse / IgM Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag4864 Product name: Recombinant human KLF15 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-416 aa of BC036733 Sequence: MVDHLLPVDENFSSPKCPVGYLGDRLVGRRAYHMLPSPVSEDDSDASSPCSCSSPDSQALCSCYGGGLGTESQDSILDFLLSQATLGSGGGSGSSIGASSGPVAWGPWRRAAAPVKGEHFCLPEFPLGDPDDVPRPFQPTLEEIEEFLEENMEPGVKEVPEGNSKDLDACSQLSAGPHKSHLHPGSSGRERCSPPPGGASAGGAQGPGGGPTPDGPIPVLLQIQPVPVKQESGTGPASPGQAPENVKVAQLLVNIQGQTFALVPQVVPSSNLNLPSKFVRIAPVPIAAKPVGSGPLGPGPAGLLMGQKFPKNPAAELIKMHKCTFPGCSKMYTKSSHLKAHLRRHTGEKPFACTWPGCGWRFSRSDELSRHRRSHSGVKPYQCPVCEKKFARSDHLSKHIKVHRFPRSSRSVRSVN Predict reactive species Full Name: Kruppel-like factor 15 Calculated Molecular Weight: 416 aa, 44 kDa Observed Molecular Weight: 44-55 kDa GenBank Accession Number: BC036733 Gene Symbol: KLF15 Gene ID (NCBI): 28999 RRID: AB_2881580 Conjugate: Unconjugated Form: Liquid Purification Method: Thiophilic affinity chromatograph UNIPROT ID: Q9UIH9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.