Iright
BRAND / VENDOR: Proteintech

Proteintech, 66190-1-Ig, IL-22RA2 Monoclonal antibody

CATALOG NUMBER: 66190-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The IL-22RA2 (66190-1-Ig) by Proteintech is a Monoclonal antibody targeting IL-22RA2 in WB, IHC, IF-P, ELISA applications with reactivity to human samples 66190-1-Ig targets IL-22RA2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Raji cells Positive IHC detected in: mouse kidney tissue, human breast cancer tissue, human lung cancer tissue, human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human breast cancer tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Interleukin-22 receptor subunit alpha-2 (IL22RA2) is a soluble member of the type II cytokine receptor family. Through binding to IL22, IL22RA2 prevents the interaction of IL22 with the functional IL22-R complex and blocks the activity of IL22 (in vitro). IL22RA2 may play an important role as an IL22 antagonist in the regulation of inflammatory responses. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Specification Tested Reactivity: human Cited Reactivity: human, pig Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18682 Product name: Recombinant human IL-22RA2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-232 aa of BC125167 Sequence: MMPKHCFLGFLISFFLTGVAGTQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP Predict reactive species Full Name: interleukin 22 receptor, alpha 2 Calculated Molecular Weight: 263 aa, 31 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC125167 Gene Symbol: IL-22RA2 Gene ID (NCBI): 116379 RRID: AB_2881585 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q969J5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924