Proteintech, 66196-1-Ig, IL-23 p19 Monoclonal antibody

Size: 20ul / 150ul The IL-23 p19 (66196-1-Ig) by Proteintech is a Monoclonal antibody targeting IL-23 p19 in IHC, ELISA applications with reactivity to human samples 66196-1-Ig targets IL-23 p19 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human stomach cancer tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Interleukin 23 (IL-23) is a member of the IL12 cytokine family and composed of two subunits, IL12p40 and IL23p19. It is produced by antigen presenting cells and has been shown to promote the production and survival of a distinct lineage of T-cells called TH17 cells. A functional receptor for IL-23 (the IL-23 receptor) has been identified and is composed of Il-12Rβ1 and IL-23R. IL-23 is expressed chiefly by the macrophages and DCs. The IL-23R is found on memory T cells, NKT cells, macrophages, DCs, and naive T cells upon activation by TGF-βand IL-6. The main biological effects of IL-23 identified initially consist of stimulation of antigen presentation by DCs, T cell differentiation to Th17 cells, and production of interferon-γ (IFN-γ). IL-23 acts also as an end-stage effector cytokine through direct action on macrophages. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag19406 Product name: Recombinant human IL-23A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 17-189 aa of BC066268 Sequence: AQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP Predict reactive species Full Name: interleukin 23, alpha subunit p19 Calculated Molecular Weight: 189 aa, 21 kDa GenBank Accession Number: BC066268 Gene Symbol: IL23A Gene ID (NCBI): 51561 RRID: AB_2881589 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9NPF7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.