Proteintech, 66221-1-Ig, Alpha E-Catenin Monoclonal antibody

Size: 20ul / 150ul The Alpha E-Catenin (66221-1-Ig) by Proteintech is a Monoclonal antibody targeting Alpha E-Catenin in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse samples 66221-1-Ig targets Alpha E-Catenin in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: NIH/3T3 cells Positive IHC detected in: human stomach tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:1000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Alpha catenin is an essential component of adherens junctions that connects E-cadherin-β-catenin complexes with the actin cytoskeleton. It also recruits a range of other important proteins to developing intercellular junctions. Three alpha catenins exist in human: alpha-E-catenin, alpha-N-catenin, and alpha-T-catenin, which share substantial amino-acid sequence similarity but have distinct tissue distribution. alpha-E-catenin is ubiquitously expressed, alpha-N-catenin is restricted to neuronal tissue, and alpha-T-catenin is primarily expressed in heart tissue. Reduced levels of alpha-E-catenin protein seem to be characteristic of many different human cancers, including malignant tumours of the breast, colon, stomach, oesophagus, bladder and liver. In addition, the loss of alpha-E-catenin often correlates with the degree of tumour differentiation and metastasis. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag23603 Product name: Recombinant human CTNNA1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 188-536 aa of BC031262 Sequence: SEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSSDPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVASTKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEFKAMDSI Predict reactive species Full Name: catenin (cadherin-associated protein), alpha 1, 102kDa Calculated Molecular Weight: 906 aa, 100 kDa Observed Molecular Weight: 95-100 kDa GenBank Accession Number: BC031262 Gene Symbol: Alpha E-Catenin Gene ID (NCBI): 1495 RRID: AB_2881612 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P35221 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.