Iright
BRAND / VENDOR: Proteintech

Proteintech, 66229-1-Ig, Haptoglobin Monoclonal antibody

CATALOG NUMBER: 66229-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Haptoglobin (66229-1-Ig) by Proteintech is a Monoclonal antibody targeting Haptoglobin in WB, IHC, ELISA applications with reactivity to human, pig samples 66229-1-Ig targets Haptoglobin in WB, IHC, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: human plasma tissue Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:20000 Immunohistochemistry (IHC): IHC : 1:4000-1:16000 Background Information HP(Haptoglobin) is also named as zonulin and belongs to the peptidase S1 family. HP, a plasma glycoprotein that binds free hemoglobin, has a tetrameric structure of 2 alpha(16 kDa and 9 kDa) and 2 beta(40 kDa) polypeptides that are covalently associated by disulfide bonds. In most species, apart from ruminants, Hp has a molecular mass of 100 kDa, consisting of two subunits of 40 kDa and two subunits of 9 kDa, although in a few species, such as man, genetic variant of Hp forms polymers of higher mass(PMID:2361363). Recent studies of haptoglobin show that certain oligosaccharide structures predominate in different diseases. For example, a highly-fucosylated structure is found in breast cancer and ovarian cancer, highly-sialylated structures in Crohn’s disease and highly branched structures in alcoholic liver disease and fucosylated haptoglobin is a good serum marker for pancreatic cancer.(PMID:16385567). Specification Tested Reactivity: human, pig Cited Reactivity: monkey Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9927 Product name: Recombinant human HP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 179-406 aa of BC058031 Sequence: MVSHHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVSVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYATGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAEN Predict reactive species Full Name: haptoglobin Calculated Molecular Weight: 281aa,31 kDa; 228aa,25 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC058031 Gene Symbol: HP Gene ID (NCBI): 3240 RRID: AB_2881620 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P00738 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924