Proteintech, 66245-1-Ig, Annexin V Monoclonal antibody

Size: 20ul / 150ul The Annexin V (66245-1-Ig) by Proteintech is a Monoclonal antibody targeting Annexin V in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, pig samples 66245-1-Ig targets Annexin V in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, pig samples. Tested Applications Positive WB detected in: MG-63 cells, HEK-293 cells, HeLa cells, human urine exosomes tissue, mouse brain tissue, Raw 264.7 cells, NIH/3T3 cells, K-562 cells, HepG2 cells, U-87 MG cells, MDA-MB-231 cells, pig brain tissue Positive IHC detected in: human malignant melanoma tissue, human colon tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: NIH/3T3 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information Annexin A5 (ANXA5), is a member of the structurally related family of annexin proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. Specification Tested Reactivity: human, mouse, pig Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag1538 Product name: Recombinant human ANXA5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-320 aa of BC001429 Sequence: MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD Predict reactive species Full Name: annexin A5 Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC001429 Gene Symbol: Annexin V Gene ID (NCBI): 308 RRID: AB_2881634 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P08758 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.