Iright
BRAND / VENDOR: Proteintech

Proteintech, 66249-1-Ig, TRIM44 Monoclonal antibody

CATALOG NUMBER: 66249-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TRIM44 (66249-1-Ig) by Proteintech is a Monoclonal antibody targeting TRIM44 in WB, IF/ICC, ELISA applications with reactivity to human samples 66249-1-Ig targets TRIM44 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: MCF-7 cells, human testis tissue Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information TRIM44 is one of the family member of TRIM protein, which contains an N-terminal ubiquitin hydrolase-type zinc-finger domain, followed by a coiled-coil domain, a zinc-finger B-box homology domain, and a second coiled-coil domain near the C-terminus. Members of the TRIM protein family are involved in various cellular processes, such as cell proliferation, oncogenesis and antiviral defense. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag18771 Product name: Recombinant human TRIM44 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-334 aa of BC024031 Sequence: MASGVGAAFEELPHDGTCDECEPDEAPGAEEVCRECGFCYCRRHAEAHRQKFLSHHLAEYVHGSQAWTPPADGEGAGKEEAEVKVEQEREIESEAGEESESEEESESEEESETEEESEDESDEESEEDSEEEMEDEQESEAEEDNQEEGESEAEGETEAESEFDPEIEMEAERVAKRKCPDHGLDLSTYCQEDRQLICVLCPVIGAHQGHQLSTLDEAFEELRSKDSGGLKAAMIELVERLKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEG Predict reactive species Full Name: tripartite motif-containing 44 Calculated Molecular Weight: 344 aa, 38 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC024031 Gene Symbol: TRIM44 Gene ID (NCBI): 54765 RRID: AB_2881637 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96DX7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924