Proteintech, 66264-1-Ig, Cytochrome c Monoclonal antibody

Size: 20ul / 150ul The Cytochrome c (66264-1-Ig) by Proteintech is a Monoclonal antibody targeting Cytochrome c in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 66264-1-Ig targets Cytochrome c in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, human heart tissue, human skeletal muscle tissue, rat skeletal muscle tissue, mouse skeletal muscle tissue, HEK-293 cells, HepG2 cells, MCF-7 cells, Jurkat cells, HSC-T6 cells, ROS1728 cells, RAW 264.7 cells Positive IHC detected in: human liver cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:5000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension Background Information Cytochrome c is a 12-15 kDa electron transporting protein located in the inner mitochondrial membrane. Upon apoptotic stimulation, cytochrome c can be released from mitochondria into cytoplasm, resulting in caspase-3 activation and apoptosis. Measurement of cytochrome c release from the mitochondria is useful for detection of the onset of apoptosis in cells. In addition, cytochrome c can also leave cells and be detectable in extra-cellular medium of apoptotic cells and serum of cancer patients. The level of serum cytochrome c may serve as a prognostic maker during cancer therapy. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, canine Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag24349 Product name: Recombinant human Cytochrome c protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-105 aa of BC009578 Sequence: MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE Predict reactive species Full Name: cytochrome c, somatic Calculated Molecular Weight: 12 kDa Observed Molecular Weight: 12-15 kDa GenBank Accession Number: BC009578 Gene Symbol: Cytochrome c Gene ID (NCBI): 54205 RRID: AB_2716798 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P99999 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.