Proteintech, 66304-1-Ig, CD47 Monoclonal antibody

Size: 20ul / 150ul The CD47 (66304-1-Ig) by Proteintech is a Monoclonal antibody targeting CD47 in WB, IF/ICC, ELISA applications with reactivity to human samples 66304-1-Ig targets CD47 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SKOV-3 cells, A549 cells, HT-1080 cells, Jurkat cells, NCI-H1299 cells, HUVEC cells, K-562 cells, TF-1 cells, human placenta tissue, HeLa cells, HaCaT cells, PANC-1 cells, MDA-MB-231 cells Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CD47, also known as integrin-associated protein (IAP), is a member of the immunoglobulin superfamily containing a five-pass transmembrane attachment. CD47 is heavily glycosylated and widely expressed by hematopoietic and nonhematopoietic cells. CD47 interacts with several membrane integrins and also acts a receptor for thrombospondin (THBS1). It is involved in a range of cellular processes, including apoptosis, proliferation, adhesion, and migration. CD47 also functions as a ligand for signal regulatory protein-α (SIRPα). Upon binding CD47, SIRPα initiates a signaling cascade that results in the inhibition of phagocytosis. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag14132 Product name: Recombinant human CD47 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of BC010016 Sequence: MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNENILIVIFPI Predict reactive species Full Name: CD47 molecule Calculated Molecular Weight: 323 aa, 35 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC010016 Gene Symbol: CD47 Gene ID (NCBI): 961 RRID: AB_2881687 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q08722 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.