Proteintech, 66310-1-Ig, TRAF3 Monoclonal antibody

Size: 20ul / 150ul The TRAF3 (66310-1-Ig) by Proteintech is a Monoclonal antibody targeting TRAF3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 66310-1-Ig targets TRAF3 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, LPS treated U-937 cells, HEK-293 cells, Raji cells, Jurkat cells, NCI-H1299 cells Positive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information TNF receptor-associated factor 3 (TRAF3) has many alternative names including CAP-1, CD40 receptor-associated factor 1(CRAF1), CD40-binding protein(CD40BP) and LMP1-associated protein 1 (LAP1). TRAF3 regulates pathways leading to the activation of NF-kappa-B and MAP kinases, and plays a central role in the regulation of innate immune response. It modulates signaling pathways leading to the production of cytokines and interferon. As an essential constituent of several E3 ubiquitin-protein ligase complexes, TRAF3 promote 'Lys-63'-linked ubiquitination of target proteins. Moreover, TRAF3 undergoes both 'Lys-48'-linked and 'Lys-63'-linked ubiquitination in response to various stimuli and is deubiquitinated by OTUB1, OTUB2 and OTUD5. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag12185 Product name: Recombinant human TRAF3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 6-351 aa of BC075087 Sequence: KMDSPGALQTNPPLKLHTDRSAGTPVFVPEQGGYKEKFVKTVEDKYKCEKCHLVLCSPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMK Predict reactive species Full Name: TNF receptor-associated factor 3 Calculated Molecular Weight: 568 aa, 64 kDa Observed Molecular Weight: 64 kDa GenBank Accession Number: BC075087 Gene Symbol: TRAF3 Gene ID (NCBI): 7187 RRID: AB_2881692 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q13114 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.