Proteintech, 66323-1-Ig, Glutamine Synthetase Monoclonal antibody

Size: 20ul / 150ul The Glutamine Synthetase (66323-1-Ig) by Proteintech is a Monoclonal antibody targeting Glutamine Synthetase in WB, IHC, IF, ELISA applications with reactivity to human, pig, zebrafish samples 66323-1-Ig targets Glutamine Synthetase in WB, IHC, IF, ELISA applications and shows reactivity with human, pig, zebrafish samples. Tested Applications Positive WB detected in: Jurkat cells, pig liver tissue, pig brain tissue Positive IHC detected in: human liver cancer tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF detected in: zebrafish retina, human brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF): IF : 1:250-1:1000 Background Information GLUL(Glutamine synthetase) is also named as GS,GLNS and belongs to the glutamine synthetase family.This enzyme has 2 functions: it catalyzes the production of glutamine and 4-aminobutanoate (gamma-aminobutyric acid, GABA), the latter in a pyridoxal phosphate-independent manner By similarity. Essential for proliferation of fetal skin fibroblasts (PMID:18662667).Defects in GLUL are the cause of congenital systemic glutamine deficiency (CSGD).Organismal glutamine production is augmented secondary to an increase in the activity of glutamine synthetase in the lung and skeletal muscle(PMID:7630137). There are other bands with higher (66 kDa, 97 kDa) and lower (30 kDa)molecular weights also detected besides the 42 kDa band indicating the proteolysis of GLUL protein by the ubiquitin system(PMID:10091759). Specification Tested Reactivity: human, pig, zebrafish Cited Reactivity: human, mouse, rat, zebrafish Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6309 Product name: Recombinant human Glutamine synthetase protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-373 aa of BC011700 Sequence: MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN Predict reactive species Full Name: glutamate-ammonia ligase (glutamine synthetase) Calculated Molecular Weight: 374 aa, 42 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC011700 Gene Symbol: Glutamine Synthetase Gene ID (NCBI): 2752 RRID: AB_2881703 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P15104 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.