Iright
BRAND / VENDOR: Proteintech

Proteintech, 66338-1-Ig, MMP3 Monoclonal antibody

CATALOG NUMBER: 66338-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MMP3 (66338-1-Ig) by Proteintech is a Monoclonal antibody targeting MMP3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 66338-1-Ig targets MMP3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: PC-12 cells, human heart tissue, HeLa cells, fetal human brain tissue, COLO 320 cells, Caco-2 cells, pig heart tissue, pig brain tissue, rat brain tissue, mouse brain tissue Positive IHC detected in: human breast cancer tissue, human colon cancer tissue, mouse colon tissue, rat colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Matrix metalloproteinases (MMPs) play a critically important role in extracellular matrix remodeling and have been implicated in a number of key normal and pathologic processes.These proteases have come to represent important therapeutic and diagnostic targets for the treatment and detection of human cancers. MMP-3 activate procollagenase via two pathways: slow direct activation and rapid activation in conjunction with tissue or plasma proteinases. The pro-MMP3 (60 kDa) and the active MMP3 (47 kDa) can be detected through western blot. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse, rat, pig, monkey Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag12359 Product name: Recombinant human MMP3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 26-477 aa of BC074869 Sequence: GEDTSMNLVQKYLENYYDLEKDVKQFVRRKDSGPVVKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVSTLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQFWAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC Predict reactive species Full Name: matrix metallopeptidase 3 (stromelysin 1, progelatinase) Calculated Molecular Weight: 477 aa, 54 kDa Observed Molecular Weight: 45-60 kDa GenBank Accession Number: BC074869 Gene Symbol: MMP3 Gene ID (NCBI): 4314 RRID: AB_2881718 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P08254 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924