Proteintech, 66339-1-Ig, RAB5A Monoclonal antibody

Size: 20ul / 150ul The RAB5A (66339-1-Ig) by Proteintech is a Monoclonal antibody targeting RAB5A in WB, IHC, IF/ICC, ELISA applications with reactivity to human, pig samples 66339-1-Ig targets RAB5A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: HEK-293 cells, fetal human brain tissue, pig brain tissue Positive IHC detected in: human liver cancer tissue, human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Rab5a belongs to the Rab GTPases family proteins, which play roles in endocytosis, exocytosis, and vesicular transportation. Rab family proteins were recently reported to play important roles in human cancer progression. Rab5a was reported to be overexpressed in breast and ovarian cancers and associated with proliferation and invasion. Specification Tested Reactivity: human, pig Cited Reactivity: human, mouse, monkey Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag16781 Product name: Recombinant human RAB5A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-215 aa of BC001267 Sequence: MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN Predict reactive species Full Name: RAB5A, member RAS oncogene family Calculated Molecular Weight: 215 aa, 24 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC001267 Gene Symbol: RAB5A Gene ID (NCBI): 5868 RRID: AB_2881719 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P20339 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.