Iright
BRAND / VENDOR: Proteintech

Proteintech, 66350-1-Ig, TLR4 Monoclonal antibody

CATALOG NUMBER: 66350-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TLR4 (66350-1-Ig) by Proteintech is a Monoclonal antibody targeting TLR4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig samples 66350-1-Ig targets TLR4 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: RAW 264.7 cells, J774A.1 cells, NIH/3T3 cells, pig liver tissue, rat liver tissue Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information TLR4, also named CD284, belongs to the Toll-like receptor family. TLR4 interacts with LY96 and CD14 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). TLR4 acts via MYD88, TIRAP and TRAF6, leading to NF-kB activation, cytokine secretion, and the inflammatory response. Three alternatively spliced transcript variants that encode different protein isoforms have been described. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse, rat, pig, rabbit, zebrafish, sheep Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag13857 Product name: Recombinant human TLR4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 653-839 aa of BC117422 Sequence: KFYFHLMLLAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAANIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLRQQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI Predict reactive species Full Name: toll-like receptor 4 Calculated Molecular Weight: 839 aa, 96 kDa Observed Molecular Weight: 100-110 kDa GenBank Accession Number: BC117422 Gene Symbol: TLR4 Gene ID (NCBI): 7099 RRID: AB_2881730 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O00206 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924