Iright
BRAND / VENDOR: Proteintech

Proteintech, 66359-1-Ig, NUP155 Monoclonal antibody

CATALOG NUMBER: 66359-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NUP155 (66359-1-Ig) by Proteintech is a Monoclonal antibody targeting NUP155 in WB, IHC, ELISA applications with reactivity to human, rat samples 66359-1-Ig targets NUP155 in WB, IHC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HEK293 cells, HeLa cells, ROS1728 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information NUP155 is a nucleoporin, the major component of the nuclear pore complex (NPC) that is essential for nuclear envelope biogenesis. Mutation of NUP155 has been linked to cardiovascular disease. Specification Tested Reactivity: human, rat Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag3638 Product name: Recombinant human NUP155 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1043-1391 aa of BC039257 Sequence: LIQVDLADKLLQVASPFLEPHLVRMAKVDQNRVRYMDLLWRYYEKNRSFSNAARVLSRLADMHSTEISLQQRLEYIARAILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAVSQLDSELMDITKLYGEFADPFKLAECKLAIIHCAGYSDPILVQTLWQDIIEKELSDSVTLSSSDRMHALSLKIVLLGKIYAGTPRFFPLDFIVQFLEQQVCTLNWDVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRMKKPLHLLDCIHVLLIRYVENPSQVLNCERRRFTNLCLDAVCGYLVELQSMSSSVAVQAITGNFKSLQAKLERLH Predict reactive species Full Name: nucleoporin 155kDa Calculated Molecular Weight: 1391 aa, 155 kDa Observed Molecular Weight: 140-155 kDa GenBank Accession Number: BC039257 Gene Symbol: NUP155 Gene ID (NCBI): 9631 RRID: AB_2881738 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O75694 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924