Iright
BRAND / VENDOR: Proteintech

Proteintech, 66363-1-Ig, CHRNA5 Monoclonal antibody

CATALOG NUMBER: 66363-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CHRNA5 (66363-1-Ig) by Proteintech is a Monoclonal antibody targeting CHRNA5 in WB, IHC, ELISA applications with reactivity to human, mouse, pig samples 66363-1-Ig targets CHRNA5 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, pig samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, human skeletal muscle tissue, C2C12 cell, pig skeletal muscle tissue, A549 cells Positive IHC detected in: human bladder tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Nicotinic acetylcholine receptors (nAChRs), such as CHRNA5, are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be (hetero)pentamers composed of homologous subunits. Variants in the CHRNA5 gene are associated with nicotine dependence and lung cancer risk. Specification Tested Reactivity: human, mouse, pig Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag4447 Product name: Recombinant human CHRNA5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 32-251 aa of BC033639 Sequence: GAQRGLSEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTPDIVLFDNADGRFEGTSTKTVIRYNGTVTWTPPANYKSSCTIDVTFFPFDLQNCSMKFGSWTYDGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYSFVIKRLPL Predict reactive species Full Name: cholinergic receptor, nicotinic, alpha 5 Calculated Molecular Weight: 468 aa, 53 kDa Observed Molecular Weight: 53 kDa GenBank Accession Number: BC033639 Gene Symbol: CHRNA5 Gene ID (NCBI): 1138 RRID: AB_2881743 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P30532 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924