Proteintech, 66389-1-Ig, FKBPL Monoclonal antibody

Size: 20ul / 150ul The FKBPL (66389-1-Ig) by Proteintech is a Monoclonal antibody targeting FKBPL in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 66389-1-Ig targets FKBPL in WB, IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-10A cells, HeLa cells, HEK-293 cells, Jurkat cells, Raji cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells, Calu-3 cells, Caco-2 cells, HepG2 cells, C6 cells Positive IHC detected in: human breast cancer tissue, human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information FKBPL, also named as DIR1, NG7 and WISp39, has similarity to the immunophilin protein family, which plays a role in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBPL levels may be a prognostic indicator and determinant of response to endocrine therapy(PMID:20103631, 15664193) .It can be detected the band between 38 kDa and 48 kDa by western blot. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0112 Product name: Recombinant human FKBPL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2-237 aa of BC004168 Sequence: ETPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELEVSPDPASQILEHTQGAEKLVAELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIVIRGHGLDKPKLGSCCRVLALGFPFGSGPPEGWTELTMGVGPWREETWGELIEKCLESMCQGEEAELQLPGHSGPPVRLTLASFTQGRDSWELETSEKEALAREERARGTELFRAGNPEGAARCYGRAL Predict reactive species Full Name: FK506 binding protein like Calculated Molecular Weight: 349 aa, 38 kDa Observed Molecular Weight: 42 kDa GenBank Accession Number: BC004168 Gene Symbol: FKBPL Gene ID (NCBI): 63943 RRID: AB_2881765 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9UIM3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.