Iright
BRAND / VENDOR: Proteintech

Proteintech, 66400-1-Ig, GATA3 Monoclonal antibody

CATALOG NUMBER: 66400-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GATA3 (66400-1-Ig) by Proteintech is a Monoclonal antibody targeting GATA3 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse samples 66400-1-Ig targets GATA3 in WB, IHC, IF/ICC, IF-P, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MCF-7 cells, Jurkat cells, RAW 264.7 cells Positive IHC detected in: human breast cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human breast cancer tissue Positive IF/ICC detected in: MCF-7 cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information GATA3 is a transcriptional factor that binds to the enhancer elements of all 4 T-cell antigen receptor genes. GATA3 is highly expressed in naive, freshly activated cells and Th2 lineage cells and thought to be necessary and sufficient for Th2 cytokine gene expression. GATA3 and TBET interfer with each other to regulate gene expression. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0174 Product name: Recombinant human GATA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 224-442 aa of BC003070 Sequence: PYVPEYSSGLFPPSSLLGGSPTGFGCKSRPKARSSTGRECVNCGATSTPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTSCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNINRPLTMKKEGIQTRNRKMSSKSKKCKKVHDSLEDFPKNSSFNPAALSRHMSSLSHISPFSHSSHMLTTPTPMHPPSSLSFGPHHPSSMVTAM Predict reactive species Full Name: GATA binding protein 3 Calculated Molecular Weight: 443 aa, 48 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC003070 Gene Symbol: GATA3 Gene ID (NCBI): 2625 RRID: AB_2881774 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P23771 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924