Iright
BRAND / VENDOR: Proteintech

Proteintech, 66413-1-Ig, ZC3HAV1 Monoclonal antibody

CATALOG NUMBER: 66413-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZC3HAV1 (66413-1-Ig) by Proteintech is a Monoclonal antibody targeting ZC3HAV1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 66413-1-Ig targets ZC3HAV1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells, HEK-293 cells, HeLa cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information he zinc-finger antiviral protein (ZAP) was originally identifed from a rat cDNA library due to its conferring resistance to retroviruses. ZC3HAV1 is a CCCH-type zinc finger protein, it may primarily function to inhibit viral gene expression and induce an innate immunity to viral infection. Alternative splicing occurs at this locus and two variants, each encoding distinct isoforms. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag10364 Product name: Recombinant human ZC3HAV1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-351 aa of BC025308 Sequence: MADPEVCCFITKILCAHGGRMALDALLQEIALSEPQLCEVLQVAGPDRFVVLETGGEAGITRSVVATTRARVCRRKYCQRPCDNLHLCKLNLLGRCNYSQSERNLCKYSHEVLSEENFKVLKNHELSGLNKEELAVLLLQSDPFFMPEICKSYKGEGRQQICNQQPPCSRLHICDHFTRGNCRFPNCLRSHNLMDRKVLAIMREHGLNPDVVQNIQDICNSKHMQKNPPGPRAPSSHRRNMAYRARSKSRDRFFQGSQEFLASASASAERSCTPSPDQISHRASLEDAPVDDLTRKFTYLGSQDRARPPSGSSKATDLGGTSQAGTSQRFLENGSQEDLLHGNPGSTYLAS Predict reactive species Full Name: zinc finger CCCH-type, antiviral 1 Calculated Molecular Weight: 699aa,78 kDa; 902aa,101 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC025308 Gene Symbol: ZC3HAV1 Gene ID (NCBI): 56829 RRID: AB_2881785 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q7Z2W4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924