Iright
BRAND / VENDOR: Proteintech

Proteintech, 66417-1-Ig, LAP3 Monoclonal antibody

CATALOG NUMBER: 66417-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LAP3 (66417-1-Ig) by Proteintech is a Monoclonal antibody targeting LAP3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 66417-1-Ig targets LAP3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: NIH/3T3 cells, C2C12 cell, HeLa cells, HepG2 cells Positive IHC detected in: human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information LAP3(Leucine aminopeptidase 3) is also named as LAPEP, PEPS(peptidase S) and belongs to the peptidase M17 family. It can catalyzes the removal of unsubstituted N-terminal amino-acids from various peptides and be presumably involved in the processing end regular turnover of intracellular proteins. PEPS is found in a wide variety of tissues and cultured cells but not in red cells and skin. The enzyme can utilize several di-, tri-, and tetrapeptides as substrates and is the slowest migrating of the peptidases after electrophoresis.(PMID:689684). LAP3 has two isoform with MW of 52 and 56 kDa. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6300 Product name: Recombinant human LAP3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 271-519 aa of BC065564 Sequence: NANEPPLVFVGKGITFDSGGISIKASANMDLMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVVRAKNGKTIQVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMTGRPTRTLIEFLLRFSQDNA Predict reactive species Full Name: leucine aminopeptidase 3 Calculated Molecular Weight: 56 kDa Observed Molecular Weight: 56 kDa GenBank Accession Number: BC065564 Gene Symbol: LAP3 Gene ID (NCBI): 51056 RRID: AB_2881789 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P28838 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924