Proteintech, 66425-1-Ig, LDHB Monoclonal antibody

Size: 20ul / 150ul The LDHB (66425-1-Ig) by Proteintech is a Monoclonal antibody targeting LDHB in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 66425-1-Ig targets LDHB in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: HEK-293 cells, PC-12 cells, Neuro-2a cells, pig brain tissue, rat brain tissue, mouse brain tissue, rabbit brain tissue, mouse cerebellum tissue, rat cerebellum tissue Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Immunohistochemistry (IHC): IHC : 1:16000-1:64000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information LDHB, also named as LDH-H and NY-REN-46, belongs to the LDH/MDH superfamily. And LDH family. It is an enzyme which catalyzes the reversible conversion of lactate and pyruvate, and NAD and NADH, in the glycolytic pathway.It is glycolytic enzymes and it is positively regulated by mTOR. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6605 Product name: Recombinant human LDHB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-334 aa of BC002362 Sequence: MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKDLKDL Predict reactive species Full Name: lactate dehydrogenase B Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC002362 Gene Symbol: LDHB Gene ID (NCBI): 3945 RRID: AB_2881796 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P07195 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.