Iright
BRAND / VENDOR: Proteintech

Proteintech, 66450-1-Ig, 4-1BBL/TNFSF9 Monoclonal antibody

CATALOG NUMBER: 66450-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The 4-1BBL/TNFSF9 (66450-1-Ig) by Proteintech is a Monoclonal antibody targeting 4-1BBL/TNFSF9 in WB, ELISA applications with reactivity to human samples 66450-1-Ig targets 4-1BBL/TNFSF9 in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SKOV-3 cells, SW 1990 cells, LoVo cells, Caki-1 cells, Caki-2 cells, SCaBER cells, Raji cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information TNFSF9, also named as 4-1BBL, belongs to the tumor necrosis factor family. It is a cytokine that binds to TNFRSF9. TNFSF9 induces the proliferation of activated peripheral blood T-cells. It may have a role in activation-induced cell death (AICD) and may play a role in cognate interactions between T-cells and B-cells/macrophages. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag12768 Product name: Recombinant human TNFSF9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 53-254 aa of BC104805 Sequence: WAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE Predict reactive species Full Name: tumor necrosis factor (ligand) superfamily, member 9 Calculated Molecular Weight: 254 aa, 27 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC104805 Gene Symbol: TNFSF9 Gene ID (NCBI): 8744 RRID: AB_2881819 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P41273 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924