Iright
BRAND / VENDOR: Proteintech

Proteintech, 66452-1-Ig, ZO-1 Monoclonal antibody

CATALOG NUMBER: 66452-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZO-1 (66452-1-Ig) by Proteintech is a Monoclonal antibody targeting ZO-1 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, canine samples 66452-1-Ig targets ZO-1 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, canine samples. Tested Applications Positive WB detected in: HUVEC cells, HeLa cells, COLO 320 cells, A431 cells, LNCaP cells, HEK-293 cells, HepG2 cells Positive IHC detected in: human pancreas cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human breast cancer tissue Positive IF/ICC detected in: MCF-7 cells, MDCK cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Tight junction (or zonula occludens) form the continuous intercellular barrier between epithelial and endothelial cells, which is required to separate tissue spaces and regulate selective movement of solutes across the epithelium and endothelium (PMID: 20066090). ZO-1 (also known as TJP1) is a peripheral membrane phosphoprotein located on the cytoplasmic face and is expressed in tight junctions of both epithelial and endothelial cells (PMID: 3528172). It binds the transmembrane proteins occludin and the claudins linking them to cytoskeletal actin (PMID: 17418867). ZO-1 belongs to a family of multidomain proteins known as the membrane-associated guanylate kinase homologs (MAGUKs). It is a pivotal tight junction protein and may be involved in signalling mechanisms regulating cell proliferation and differentiation (PMID: 22782886). Specification Tested Reactivity: human, canine Cited Reactivity: human, pig, canine Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag16454 Product name: Recombinant human ZO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1446-1748 aa of BC111712 Sequence: SLHIHSKGAHGEGNSVSLDFQNSLVSKPDPPPSQNKPATFRPPNREDTAQAAFYPQKSFPDKAPVNGTEQTQKTVTPAYNRFTPKPYTSSARPFERKFESPKFNHNLLPSETAHKPDLSSKTPTSPKTLVKSHSLAQPPEFDSGVETFSIHAEKPKYQINNISTVPKAIPVSPSAVEEDEDEDGHTVVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNSILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCDPKTWQNKCLPGDPNYLVGANCVSVLIDHF Predict reactive species Full Name: tight junction protein 1 (zona occludens 1) Calculated Molecular Weight: 1748 aa, 195 kDa Observed Molecular Weight: 230 kDa GenBank Accession Number: BC111712 Gene Symbol: ZO-1 Gene ID (NCBI): 7082 RRID: AB_2881821 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q07157 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924