Proteintech, 66453-1-Ig, GNPAT Monoclonal antibody

Size: 20ul / 150ul The GNPAT (66453-1-Ig) by Proteintech is a Monoclonal antibody targeting GNPAT in WB, IHC, ELISA applications with reactivity to human samples 66453-1-Ig targets GNPAT in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, COLO 320 cells, HepG2 cells Positive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information GNPAT, also named as DAPAT and DHAPAT, belongs to the GPAT/DAPAT family. It is a key enzyme in the biosynthesis of ether phospholipids. GNPAT is localized exclusively within peroxisomes. Full GNPAT activity depends not only on the presence of AGPS, but also on the integrity of substrate channeling from GNPAT to AGPS. (PMID: 21990100) This antibody recognize the 65-69 kDa GNPAT protein. Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6740 Product name: Recombinant human GNPAT protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 331-680 aa of BC000450 Sequence: PVSLRSLAAGRMSRSSYNLVPRYIPQKQSEDMHAFVTEVAYKMELLQIENMVLSPWTLIVAVLLQNRPSMDFDALVEKTLWLKGLTQAFGGFLIWPDNKPAEEVVPASILLHSNIASLVKDQVILKVDSGDSEVVDGLMLQHITLLMCSAYRNQLLNIFVRPSLVAVALQMTPGFRKEDVYSCFRFLRDVFADEFIFLPGNTLKDFEEGCYLLCKSEAIQVTTKDILVTEKGNTVLEFLVGLFKPFVESYQIICKHLLSEEEDHFSEEQYLAAVRKFTSQLLDQGTSQCYDVLSSDVQKNALAACVRLGVVEKKKINNNCIFNVNEPATTKLEEMLGCKTPIGKPATAKL Predict reactive species Full Name: glyceronephosphate O-acyltransferase Calculated Molecular Weight: 77 kDa Observed Molecular Weight: 65-69 kDa GenBank Accession Number: BC000450 Gene Symbol: GNPAT Gene ID (NCBI): 8443 RRID: AB_2881822 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O15228 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.