Iright
BRAND / VENDOR: Proteintech

Proteintech, 66461-1-Ig, OIP5 Monoclonal antibody

CATALOG NUMBER: 66461-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The OIP5 (66461-1-Ig) by Proteintech is a Monoclonal antibody targeting OIP5 in WB, ELISA applications with reactivity to human samples 66461-1-Ig targets OIP5 in WB, IP, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells, COLO 320 cells, Raji cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information OIP5, also named as IS18B and CT86, is required for recruitment of CENPA to centromeres and normal chromosome segregation during mitosis. It is over expressed in the majority of primary lung and esophageal cancers. OIP5 is a promising target for developing new prognostic biomarkers and anti-cancer drugs. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag2790 Product name: Recombinant human OIP5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-229 aa of BC015050 Sequence: MAAQPLRHRSRCATPPRGDFCGGTERAIDQASFTTSMEWDTQVVKGSSPLGPAGLGAEEPAAGPQLPSWLQPERCAVFQCAQCHAVLADSVHLAWDLSRSLGAVVFSRVTNNVVLEAPFLVGIEGSLKGSTYNLLFCGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVTPDQSKPEN Predict reactive species Full Name: Opa interacting protein 5 Calculated Molecular Weight: 229 aa, 25 kDa Observed Molecular Weight: 25-30 kDa GenBank Accession Number: BC015050 Gene Symbol: OIP5 Gene ID (NCBI): 11339 RRID: AB_2881830 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O43482 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924